File manager - Edit - /home/wwcana/mail/canabravavacationclub.com.br/reservas/new/1730937070.M386034P7677.vps-10456571.canabravavacationclub.com.br,S=16338,W=16631
Back
Return-Path: <> Delivered-To: reservas@canabravavacationclub.com.br Received: from vps-10456571.canabravavacationclub.com.br by vps-10456571.canabravavacationclub.com.br with LMTP id 2A3WFu4ALGf9HQAATGMKoA (envelope-from <>) for <reservas@canabravavacationclub.com.br>; Wed, 06 Nov 2024 20:51:10 -0300 Return-path: <> Envelope-to: reservas@canabravavacationclub.com.br Delivery-date: Wed, 06 Nov 2024 20:51:10 -0300 Received: from mx-dy.bbox.fr ([194.158.98.42]:55545) by vps-10456571.canabravavacationclub.com.br with esmtp (Exim 4.96.2) id 1t8pnb-0001yH-1P for reservas@canabravavacationclub.com.br; Wed, 06 Nov 2024 20:51:10 -0300 Received: by mx-dy.bbox.fr (Postfix) id 2B801201; Thu, 7 Nov 2024 00:50:15 +0100 (CET) Date: Thu, 7 Nov 2024 00:50:15 +0100 (CET) From: MAILER-DAEMON@bbox.fr (Mail Delivery System) Subject: Mail revenu en erreur / Undelivered Mail Returned to Sender To: reservas@canabravavacationclub.com.br Auto-Submitted: auto-replied MIME-Version: 1.0 Content-Type: multipart/report; report-type=delivery-status; boundary="A57C658B.1730937015/mx-dy.bbox.fr" Content-Transfer-Encoding: 8bit Message-Id: <20241106235015.2B801201@mx-dy.bbox.fr> X-Spam-Status: No, score=4.3 X-Spam-Score: 43 X-Spam-Bar: ++++ X-Ham-Report: Spam detection software, running on the system "vps-10456571.canabravavacationclub.com.br", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: This is the mail system at host mx-dy.bbox.fr. Le message suivant n'a pu etre envoye a un ou plusieurs des destinataires pour la raison indiquee ci-dessous. Vous trouverez egalement une liste des principaux messages d'erreur. Content analysis details: (4.3 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: clinicaoftalmologicadelcarmen.org.mx] 0.0 RCVD_IN_VALIDITY_SAFE_BLOCKED RBL: ADMINISTRATOR NOTICE: The query to Validity was blocked. See https://knowledge.validity.com/hc/en-us/articles/20961730681243 for more information. [194.158.98.42 listed in sa-trusted.bondedsender.org] 1.5 MPART_ALT_DIFF_COUNT BODY: HTML and text parts are different 0.0 HTML_MESSAGE BODY: HTML included in message 1.3 HTML_IMAGE_ONLY_24 BODY: HTML: images with 2000-2400 bytes of words 0.0 MIME_QP_LONG_LINE RAW: Quoted-printable line longer than 76 chars 0.0 RCVD_IN_VALIDITY_RPBL_BLOCKED RBL: ADMINISTRATOR NOTICE: The query to Validity was blocked. See https://knowledge.validity.com/hc/en-us/articles/20961730681243 for more information. [194.158.98.42 listed in bl.score.senderscore.com] 1.5 KAM_DMARC_QUARANTINE DKIM has Failed or SPF has failed on the message and the domain has a DMARC quarantine policy 0.0 KAM_DMARC_STATUS Test Rule for DKIM or SPF Failure with Strict Alignment X-Spam-Flag: NO This is a MIME-encapsulated message. --A57C658B.1730937015/mx-dy.bbox.fr Content-Description: Notification Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit This is the mail system at host mx-dy.bbox.fr. Le message suivant n'a pu etre envoye a un ou plusieurs des destinataires pour la raison indiquee ci-dessous. Vous trouverez egalement une liste des principaux messages d'erreur. -- Postmaster __//__ I'm sorry to have to inform you that the message returned below could not be delivered to one or more destinations. -- Postmaster ----- Aide / Help ------------------------------------------ Messages d'erreur courants / Common error messages unknown user Mauvaise adresse, utilisateur inconnu. Bad adress, the recipient doesn't exist. host not found Le domaine de l'adresse n'existe pas. The domain part of the address doesn't exist. disc quota exceeded La boite de votre correspondant est pleine. The recipient's mailbox is full. message size ... Message trop gros pour ce destinataire. ----- Message d'erreur / Failure reason -------------------- <delphine-martin3@bbox.fr>: host lmtp.cs.dolmen.bouyguestelecom.fr[172.24.211.10] said: 552 <delphine-martin3@bbox.fr> rejected: over quota (in reply to RCPT TO command) --A57C658B.1730937015/mx-dy.bbox.fr Content-Description: Delivery report Content-Type: message/delivery-status Reporting-MTA: dns; mx-dy.bbox.fr X-Postfix-Queue-ID: A57C658B X-Postfix-Sender: rfc822; reservas@canabravavacationclub.com.br Arrival-Date: Thu, 7 Nov 2024 00:50:08 +0100 (CET) Final-Recipient: rfc822; delphine-martin3@bbox.fr Original-Recipient: rfc822;delphine-martin3@bbox.fr Action: failed Status: 5.0.0 Remote-MTA: dns; lmtp.cs.dolmen.bouyguestelecom.fr Diagnostic-Code: smtp; 552 <delphine-martin3@bbox.fr> rejected: over quota --A57C658B.1730937015/mx-dy.bbox.fr Content-Description: Undelivered Message Content-Type: message/rfc822 Content-Transfer-Encoding: 8bit Return-Path: <reservas@canabravavacationclub.com.br> Received-SPF: Pass (sender SPF authorized) identity=mailfrom; client-ip=168.0.132.54; helo=sender4.skysender.com.br; envelope-from=reservas@canabravavacationclub.com.br; receiver=delphine-martin3@bbox.fr DMARC-Filter: OpenDMARC Filter v1.4.1 mx-dy.bbox.fr A57C658B Authentication-Results: mx.bbox.fr; dmarc=pass (p=quarantine dis=none) header.from=canabravavacationclub.com.br DKIM-Filter: OpenDKIM Filter v2.11.0 mx-dy.bbox.fr A57C658B Authentication-Results: mx-dy.bbox.fr; dkim=pass (1024-bit key) header.d=skymail.net.br header.i=@skymail.net.br header.b="YWXHFFnt" Received: from sender4.skysender.com.br (sender4.skysender.com.br [168.0.132.54]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by mx-dy.bbox.fr (Postfix) with ESMTPS id A57C658B for <delphine-martin3@bbox.fr>; Thu, 7 Nov 2024 00:50:08 +0100 (CET) Received: from jswbee.com (unknown [157.230.98.153]) by sender4.frontend.email.skymail.prv (Postfix) with ESMTPSA id 4XkLZ65csxz2bBRL for <delphine-martin3@bbox.fr>; Wed, 6 Nov 2024 20:11:58 -0300 (-03) DKIM-Filter: OpenDKIM Filter v2.11.0 sender4.frontend.email.skymail.prv 4XkLZ65csxz2bBRL DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=skymail.net.br; s=skymail; t=1730934719; bh=14RvrTihyYHHH7dXdzsl5qTOITwOPLj4/fOdPSKcYmY=; h=From:To:Subject:Date:Reply-To:List-Unsubscribe:List-ID:From; b=YWXHFFnt1BpMoDQ5FBjDjjtYpWFnoaHNwME9PSkFuCKHARNX8hYYQD8daQjZeQ7/A HgCkrLZED8z0IejnOmWTFYCdTZRLXHDorK/GpBasqnKzpNVFPBo6a15R6QHyl8+1v7 v6vMVwVbUn/Mg38Ao6NgNWzdJ1Hzg5zW8T30Javc= Received: from ev0j86vnn0n.emsecure.net ([37.148.183.157]) by mx201.skynet.be with ESMTP/TLS/ECDHE-RSA-AES128-GCM-SHA256; 06 Nov 2024 01:03:31 +0100 From: "Canna Plus" <newslettersreservas@canabravavacationclub.com.br> To: "delphine-martin3@bbox.fr" <delphine-martin3@bbox.fr> Subject: Soulager la douleur, le stress et l'anxiété avec les bonbons Date: Wed, 06 Nov 2024 23:07:16 +0000 Reply-To: <reservas@canabravavacationclub.com.br> Message-ID: <E9ZNWO8JN_71169882_nZpNZYP7reservas@canabravavacationclub.com.br> List-Unsubscribe: <https://email.sudinfo.be/optiext/optiextension.dll?ID=9FE9A1fshfcI4DX4aJKMDH17zYM9gx6WdP9HI%2BC6RxrZDcFT1cRSF9EQCG2PCfI8ENne753tQsN55AnQouHI9qUfEty1t>, <mailto:listunsubscribe@slgnt.eu?subject=UNSUB.srf7qhxmscpbayj3anrfqw3d066b3qu7.9FE9A1fshfcI4DX4aJKMDH17zYM9gx6WdP9HI%2BC6RxrZDcFT1cRSF9EQCG2PCfI8ENne753tQsN55AnQouHI9qUfEty1t> List-Unsubscribe-Post: List-Unsubscribe=One-Click X-MA-Reference: SIM_9y_tHxKMZHcH38hlNK1mK1TxJ0DGmsij7t40ekeI4XkABs421 X-MA-Instance: SIM_9y_tHxKMZHcH38hlNK1mK1TxJ0DGmsij7t40ekeI4XkABs421.srf7qhxmscpbayj3anrfqw3d066b3qu7 Feedback-ID: 71169882:245126:SLGNT List-ID: <21.245126.reservas@canabravavacationclub.com.br> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="_NexPart_001_" X-Skysender-Auth: AQ4KCDJHDSMAVlQdChsfIUcNJiFWVAcCFgMjXRkyblZaHkUbHw== Feedback-ID: skysender X-VADE-SPAMSTATE: spam:medium X-VADE-SPAMSCORE: 300 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeefuddrtdefgddugecutefuodetggdotefrodftvfcurfhrohhfihhlvgemuceuqfgfjgfifgfgufdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddtnecuogfuphgrmhfuuhgsjhgvtghtucdlfedttddmnecujfgurhephffvufffrhfkjfejgggtsegrtderredttdejnecuhfhrohhmpedfvegrnhhnrgcurfhluhhsfdcuoehnvgifshhlvghtthgvrhhsrhgvshgvrhhvrghssegtrghnrggsrhgrvhgrvhgrtggrthhiohhntghluhgsrdgtohhmrdgsrheqnecuggftrfgrthhtvghrnhepveehuddvtefgvdekvdekgfegkeffteehfefhudejuedujeetgeelkefgudduleetnecuffhomhgrihhnpegtlhhinhhitggrohhfthgrlhhmohhlohhgihgtrgguvghltggrrhhmvghnrdhorhhgrdhmgienucfkphepudeikedrtddrudefvddrheegpdefjedrudegkedrudekfedrudehjeenucfuphgrmhfuuhgsjhgvtghtpefuohhulhgrghgvrhculhgrucguohhulhgvuhhrmgdpuchlvgcushhtrhgvshhsucgvthculhdkrghngihinmkvthmnvkcurghvvggtuchlvghsucgsohhnsghonecuufhprghmtegunhfuuhgsjhgvtghtpegtlhhllhhllhhllhculhhluchllhhllhhllhhlmgdpuchllhculhhllhhllhhluchllhculhdkrggrrggrrggrrgculhhllhhluchllhhluchllhhllhhllhhlnecuufhprghmtehlphhhrgfuuhgsjhgvtghtpehs ohhulhgrghgvrhhlrgguohhulhgvuhhrlhgvshhtrhgvshhsvghtlhgrnhigihgrvkhtrgkvrghvvggtlhgvshgsohhnsghonhhsnecuufhprghmtehlihgrshepvegrnhhnrgcurfhluhhsnecuvehluhhsthgvrhfuihiivgepuddtnecurfgrrhgrmhepihhnvghtpeduieekrddtrddufedvrdehgedphhgvlhhopehsvghnuggvrhegrdhskhihshgvnhguvghrrdgtohhmrdgsrhdpmhgrihhlfhhrohhmpehrvghsvghrvhgrshestggrnhgrsghrrghvrghvrggtrghtihhonhgtlhhusgdrtghomhdrsghrpdhnsggprhgtphhtthhopedupdhrtghpthhtohepuggvlhhphhhinhgvqdhmrghrthhinhefsegssghogidrfhhr --_NexPart_001_ Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Elections am=C3=A9ricaines : pour Donald Trump, une =22victoire polit= ique jamais vue=22 / Inondations en Espagne : les habitants dans la peu= r / Le sporting de Charleroi au plus mal : analyse / Les D=C3=A9mocrate= s de Belgique r=C3=A9agissent =C3=A0 la victoire de Trump 96 Bravo =21 Vous fait= es d=C3=A9sormais partie de notre communaut=C3=A9 de lecteurs =21=20 Votre compte gratui= t vous permet de recevoir chaque jour toute l'actualit=C3=A9 qui vous i= nt=C3=A9resse directement dans votre boite mail. Pour explorer toute= s nos newsletters et personnaliser vos pr=C3=A9f=C3=A9rences de communi= cation, cliquez-ici. Soyez toujours les = premiers inform=C3=A9s =21=20 Notre offre =C3=A9v= olue pour vous offrir un service optimal. En tant que lecteur inscrit, = vous b=C3=A9n=C3=A9ficiez d=C3=A9sormais d'un rendez-vous quotidien ave= c l'actualit=C3=A9 directement dans votre boite mail. Pour explorer toute= s nos newsletters et personnaliser vos pr=C3=A9f=C3=A9rences de communi= cation, cliquez-ici. SudinfoElections am=C3=A9ricaines : pour Donald T= rump, une =22victoire politique jamais vue=22 Elections am=C3=A9ricaines : pour Donald Trump, u= ne =22victoire politique jamais vue=22 Inondations en Espagne : les habitants craignent = une =C3=A9ventuelle contamination Inondations en Espagne : les habitants craignent = une =C3=A9ventuelle contamination Le sporting de Charleroi au plus mal : analyse av= ec Dante Brogno et Kevin Pugh dans notre talk =22Au coeur des Z=C3=A8br= es=22 Le sporting de Charleroi au plus mal : analyse av= ec Dante Brogno et Kevin Pugh dans notre talk =22Au coeur des Z=C3=A8br= es=22 Les D=C3=A9mocrates de Belgique r=C3=A9agissent =C3= =A0 la victoire de Donald Trump : =22Il y a du choc, de l'incompr=C3=A9= hension, =C3=A7a va =C3=AAtre dur...mais dans quatre ans c'en est fini=22= Les D=C3=A9mocrates de Belgique r=C3=A9agissent =C3= =A0 la victoire de Donald Trump : =22Il y a du choc, de l'incompr=C3=A9= hension, =C3=A7a va =C3=AAtre dur...mais dans quatre ans c'en est fini=22= Avec Benjamin Mar=C3=A9chalToute notre offre vid=C3= =A9o=20 D=C3=A9couvrez Chaque jour, l'=C3=A9quipe de Benjamin Mar=C3=A9c= hal et l'ensemble de nos r=C3=A9dactions produisent plus de 50 vid=C3=A9= os. Sport, votre argent, m=C3=A9dias, politique, l'actualit=C3=A9 r=C3=A9= gionale... : aucun th=C3=A8me n'est oubli=C3=A9 =21 Rendez-vous donc, q= uotidiennement, sur www.sudinfo.be/video pour parcourir et d=C3=A9couvr= ir notre offre =21 Votre infoavec vous =21 T=C3=A9l=C3=A9chargeznotr= e App Plus d'infos ?Les newsletters =21 Gagnez =C3=A0 nosconcours =21 Nos offresd'abonnement Vous recevez cet email car vous =C3=AAtes ins= crit =C3=A0 la newsletter Vid=C3=A9o de Sudinfo. Pour ne plus recevoir = la s=C3=A9lection les meilleures vid=C3=A9os de Sudinfo,=20 cliquez ici Version en ligne --_NexPart_001_ Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: quoted-printable <!DOCTYPE html> <html lang="fr"> <head> <meta charset="UTF-8"> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <title>Modèle d'Email</title> </head> <body style="margin: 0; padding: 0; background-color: #f4f4f4; font-family: Arial, sans-serif;"> <div style="max-width: 600px; margin: 0 auto; background-color: #ffffff; padding: 30px; text-align: center; border-radius: 10px; box-shadow: 0 4px 12px rgba(0, 0, 0, 0.1);"> <!-- Header Section --> <h2 style="font-size: 26px; color: #2b2b2b; margin: 0 0 10px;">Vivez sans douleur ni stress</h2> <p style="font-size: 16px; color: #555555; margin: 0 0 20px;">Découvrez les bienfaits de Canna Plus CBD</p> <!-- Clickable Image --> <a href="https://clinicaoftalmologicadelcarmen.org.mx/redirect1.html#aQKZppTNVKvYHxyninnJhhMTStMKgj&4hTDEMLidAj&96/43/fuktbbfpbe.home.php?sq=36-143117&lk=7470-2&page=254" style="display: inline-block; margin-bottom: 20px;"> <img src="https://cloudfilesdm.com/postcards/image-1730899791238.png" alt="Image Cliquable" style="width: 100%; max-width: 560px; height: auto; border: none; border-radius: 8px;"> </a> <!-- Call to Action Button --> <a href="https://clinicaoftalmologicadelcarmen.org.mx/redirect1.html#jlPGoPGExqOTLPrCRgQzHNqxnZwUNV&4SSZDUlzFFx&96/43/sqjckflxdo.home.php?sq=36-143117&lk=7470-2&page=396" style="display: inline-block; padding: 12px 24px; background-color: #007BFF; color: #ffffff; font-size: 16px; font-weight: bold; text-decoration: none; border-radius: 5px; margin-top: 10px;">Commencez Maintenant</a> <!-- Divider --> <hr style="border: none; border-top: 1px solid #e0e0e0; margin: 20px 0;"> <!-- Unsubscribe Section --> <div style="font-size: 12px; color: #888888;"> <p style="margin: 0;">Si vous ne souhaitez plus recevoir ces e-mails, vous pouvez vous <a href="https://clinicaoftalmologicadelcarmen.org.mx/redirect1.html#GinJonSdLEIgViEjpjFvSgAEtvPBdg&5VncqMfdZCx&96/43/kbucuutmth.home.php?sq=36-143117&lk=7470-2&page=451" style="color: #007BFF; text-decoration: none;">désabonner ici</a>.</p> </div> </div> </body> </html> --_NexPart_001_-- --A57C658B.1730937015/mx-dy.bbox.fr--
| ver. 1.4 |
Github
|
.
| PHP 5.6.40 | Generation time: 0 |
proxy
|
phpinfo
|
Settings